PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10001451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRAS
Protein Properties Length: 438aa    MW: 50395.8 Da    PI: 7.9498
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10001451genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS269.21.3e-82454221374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn...sseelaalklfsevsPilkfs 94 
                  l +lLl++Ae v  ++  +a++lL+r + +as + ++ qR++++f+eAL++r+ r  ++ +++   p ++ ++     s +  a   +++  P+ ++ 
  Lus10001451  45 LAHLLLAAAEKVGFHQYDRASKLLTRCEWIASDRSNAAQRIVHCFAEALRERIDRgLGKFIVRMPDPFPSFNSMynnGSGTNLASICLHQKAPFSQVM 142
                  579****************************************************666666655544433322223355555555669********** PP

         GRAS  95 hltaNqaIleavege.ervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak.rle 187
                  ++t+ q I e + ++ +++H iD++i  G+ W aL+qaLa+R        +lR+T++++ +  ++  +e tg+rL++fA++++ pf+f+v++ +  l+
  Lus10001451 143 QMTTVQSIIENIGTSaRKLHCIDLEIRSGVIWTALMQALANRGadcVMVEHLRVTAIARIS--ERYHVEDTGRRLESFARSMNFPFSFHVVYINtCLS 238
                  ************9997899***********************95444588*********55..999*************************666599* PP

         GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                  d++ + +rv  +E+++V + + l +ll ++  le     +++++k+l+P+++vv e ea+hns+ F++rf+e+l yysa fdsle+ + ++ e r+ +
  Lus10001451 239 DIREDVFRVTFDETVVVVCTFILRTLLGRPERLER----LMRVLKNLNPTLMVVGETEANHNSPVFVNRFIESLFYYSAYFDSLETCMREDVEYRTAI 332
                  ***************************88888887....*************************************************9999****** PP

         GRAS 286 ErellgreivnvvacegaerrerhetlekWrerlee.aGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  E+  l+  ++n+v +eg+er+ rh +le Wr  +++ + + ++ +s++ + qa+l++++++ +   ++e++ + l++gWk+ pL+s+SaW+
  Lus10001451 333 EAT-LSHGLRNMVVMEGNERTSRHVKLEVWRTFFSTrFKMVELGFSKTSTYQASLVIKQFQeWSSCSIEKDGEGLTIGWKGTPLFSLSAWK 422
                  **9.*****************************9864888888999***************8888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.8619401IPR005202Transcription factor GRAS
PfamPF035144.5E-8045422IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MRVAGERYIQ FSEHHRCDDF SILMHPFGYA LSAGLSEEET KDVELAHLLL AAAEKVGFHQ  60
YDRASKLLTR CEWIASDRSN AAQRIVHCFA EALRERIDRG LGKFIVRMPD PFPSFNSMYN  120
NGSGTNLASI CLHQKAPFSQ VMQMTTVQSI IENIGTSARK LHCIDLEIRS GVIWTALMQA  180
LANRGADCVM VEHLRVTAIA RISERYHVED TGRRLESFAR SMNFPFSFHV VYINTCLSDI  240
REDVFRVTFD ETVVVVCTFI LRTLLGRPER LERLMRVLKN LNPTLMVVGE TEANHNSPVF  300
VNRFIESLFY YSAYFDSLET CMREDVEYRT AIEATLSHGL RNMVVMEGNE RTSRHVKLEV  360
WRTFFSTRFK MVELGFSKTS TYQASLVIKQ FQEWSSCSIE KDGEGLTIGW KGTPLFSLSA  420
WKFSRDRLGR FFNYRFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-317542233375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302767.10.0hypothetical protein POPTR_0002s19660g
TrEMBLB9GST20.0B9GST2_POPTR; Uncharacterized protein
STRINGPOPTR_0002s19660.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17490.13e-49RGA-like protein 3